half-life raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-10-05. Anything still debated is marked as such rather than presented as settled.
Semaglutide is a synthetic peptide that acts as an agonist at the glucagon-like peptide-1 receptor. It is a structural analogue of human GLP-1(7-37), modified to resist enzymatic degradation by dipeptidyl peptidase-4. The peptide backbone contains alpha-aminoisobutyric acid at position 8, a substitution that stabilises the helix and slows cleavage. A fatty diacid side chain attached through a linker at lysine 34 promotes binding to serum albumin, which extends the circulating half-life. These two modifications together allow less frequent administration than native GLP-1 requires.
Activation of the GLP-1 receptor couples to Gs signalling and raises intracellular cyclic AMP in pancreatic beta cells. The resulting insulin release depends on prevailing glucose concentrations, so the effect is greater when glucose is elevated. Receptor engagement also suppresses glucagon secretion and slows gastric emptying, which flattens post-meal glucose excursions. In the central nervous system, signalling in hypothalamic and brainstem regions is associated with reduced appetite and lower energy intake. Studies continue to examine effects on cardiac, renal and hepatic endpoints; whether those benefits are independent of weight change remains an open question.
Clinical development of this compound followed earlier short-acting GLP-1 analogues that required frequent injection. Once-weekly subcutaneous formulations entered use after 2017, and an oral formulation using a permeation enhancer later became available. The oral version pairs the peptide with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, a carrier that improves uptake across the gastric epithelium. Interest has expanded from glycaemic control into weight management and metabolic liver disease. Regulatory status and approved indications differ between countries, and the product remains subject to ongoing safety monitoring.
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, developed by Novo Nordisk and first approved in 2017 for type 2 diabetes. It belongs to the incretin mimetic class, a group of agents that reproduce the glucose-dependent actions of endogenous GLP-1. The molecule was engineered to resist degradation by dipeptidyl peptidase-4 and to bind serum albumin, extending its half-life from minutes to roughly one week. Approval for chronic weight management followed in 2021, based on large cardiovascular and obesity outcome trials.
GLP-1 receptors are expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises cyclic AMP, enhances glucose-dependent insulin secretion, and suppresses glucagon release when blood glucose is high. Effects on gastric emptying and on hypothalamic appetite circuits reduce energy intake. Because insulin release remains glucose-dependent, the risk of hypoglycemia is low when the drug is used alone. The precise contribution of each pathway to body weight change in humans remains an area of active investigation.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C187H291N45O59 | Parent peptide; salt forms also reported |
| Molecular mass | about 4113.6 Da | Average mass of the free peptide |
| Peptide length | 31 amino acids | Backbone related to GLP-1(7-37) |
| Key substitution | Aib at position 8 | Blocks DPP-4 cleavage |
| Albumin binding | Via C-18 diacid side chain | Prolongs circulation time |
Identity and purity are usually assessed by reverse-phase high-performance liquid chromatography coupled to mass spectrometry. Retention time and observed mass are compared against a reference standard run under identical conditions. Impurity profiles reveal deamidation products, oxidized methionine variants, and truncated fragments that arise during synthesis or storage. Peptide mapping through enzymatic digestion confirms the primary sequence, while amino acid analysis offers an independent check on overall composition.
Stability studies examine how temperature, pH, and moisture influence degradation rates over time. In aqueous solution, hydrolysis and deamidation accelerate as pH moves away from mildly acidic conditions. Light exposure and residual metal ions can also trigger oxidation of susceptible residues. Accelerated aging at elevated temperature is used to estimate shelf life, though extrapolation to room temperature carries uncertainty because individual degradation pathways do not always scale predictably.
Peptide degradation follows several routes. Hydrolysis cleaves the backbone at susceptible residues, oxidation targets methionine and tryptophan side chains, and aggregation produces higher-molecular-weight species that are difficult to reverse. Light exposure accelerates oxidation, which is why amber glass or opaque secondary packaging is common. Repeated freeze-thaw cycles promote aggregation and are best avoided. Stability-indicating methods detect these changes before they become visible.
Quality control for research material typically involves reversed-phase HPLC for purity and identity, mass spectrometry for molecular weight confirmation, and Karl Fischer titration for residual water content. Peptide content is often reported as the mass of actual peptide rather than total powder mass, since counterions and water contribute to the latter. A certificate of analysis should list the method used for each specification. Limits and acceptance criteria vary by supplier and by intended application.
Handling practices center on minimizing contamination and adsorption. Lyophilized peptide tends to accumulate static charge, so weighing is done with antistatic measures and calibrated balances. Reconstitution with appropriate solvent should be gentle, avoiding vigorous vortexing that generates foam and shear. Solutions are typically aliquoted before freezing to reduce repeated temperature cycling. Personal protective equipment and a fume hood are standard for powder handling.
The primary target is the GLP-1 receptor, a class B G protein-coupled receptor expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises intracellular cyclic AMP, which potentiates glucose-dependent insulin secretion and lowers glucagon release when blood glucose is elevated. Signalling in the hypothalamus and brainstem is associated with reduced appetite and slower gastric emptying. Because the insulinotropic effect depends on prevailing glucose levels, the hypoglycaemic risk of the peptide alone is described as low in most study settings. The relative contribution of peripheral and central actions remains an active research question.
Large randomised trials in adults with type 2 diabetes and in adults with obesity have reported reductions in body weight and improvements in several cardiovascular risk markers. One outcome trial found a lower incidence of major adverse cardiovascular events in participants with diabetes and established cardiovascular disease. Gastrointestinal effects such as nausea and vomiting are the most frequently reported adverse events and often diminish over time. Changes in lean body mass during weight loss are an area of ongoing investigation. Effects in adolescents and in pregnancy are less well characterised, and current labelling advises against use during pregnancy.
Previously, many studies used Mass Spectrometry (MS) in different fragmentation modes to detect AMPylated peptides. In responses to the distinctive fragmentation techniques, AMPylated protein sequences disintegrated at different parts of AMP. While electron transfer dissociation (ETD) creates minimum fragments and less complicated spectra, collision-induced dissociation (CID) and high-energy collision (HCD) fragmentation generate characteristic ions suitable for AMPylated proteins identification by generating multiple AMP fragments. Due to AMP's stability, peptide fragmentation spectra is easy to read manually or with search engines. Inhibitors of protein AMPylation with inhibitory constant (Ki) ranging from 6 - 50 μM and at least 30-fold selectivity versus HypE have been discovered.
2,5-Diketopiperazine is an organic compound with the formula (NHCH2C(O))2. The compound features a six-membered ring containing two amide groups at opposite positions in the ring. It was first compound containing a peptide bond to be characterized by X-ray crystallography in 1938. It is the parent of a large class of 2,5-Diketopiperazines (2,5-DKPs) with the formula (NHCH2(R)C(O))2 (R = H, CH3, etc.). They are ubiquitous peptides in nature. They are often found in fermentation broths and yeast cultures as well as embedded in larger more complex architectures in a variety of natural products as well as several drugs. In addition, they are often produced as degradation products of polypeptides, especially in foods and beverages. They have also been found in extraterrestrial objects such as comets and asteroids.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
In 2011, actor John Abraham responding to allegations that his face looked "puffy" from steroid use stated that he used "No steroids" and used protein and multivitamins. In a 2013 interview, British-Indian model Upen Patel also refutes ever taking steroids, and states that he was always athletic. In 2018, actor Sanjay Dutt refused the allegations that his 1990s physique was due to steroids use, arguing that back then both steroids and protein powders weren't widespread, Dutt saying that he relied only on diet. http://in.movies.yahoo.com/news-detail/17113/Stars-steroids-enhance-performance.html
62. Tirzepatide. Farzam K(1), Patel P. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2026 Jan–. 2026 Sep 14. Author information: (1)McMaster University Tirzepatide is a medication approved by the US Food and Drug Administration (FDA) for the treatment of type 2 diabetes, obesity, and obstructive sleep apnea. As a dual agonist of the glucagon-like peptide-1 and glucose-dependent insulinotropic polypeptide receptors, it improves glycemic control and reduces body weight in patients with type 2 diabetes. Administered once weekly via subcutaneous injection with incremental dose adjustments, tirzepatide is used as a second-line diabetes medication. Tirzepatide is not approved for the treatment of type 1 diabetes and has not been adequately studied in patients with pancreatitis. Common adverse effects are gastrointestinal, including nausea, vomiting, and diarrhea. This activity provides an overview of the indications, mechanism of action, administration, adverse effects, contraindications, drug interactions, and considerations for specific patient populations. The activity also enhances clinicians’ competence in administering tirzepatide, monitoring treatment response and adverse effects, and managing patients with type 2 diabetes to improve patient outcomes and safety. Copyright © 2026, StatPearls Publishing LLC.
A/B testing (also known as bucket testing, split-run testing or split testing) is a user-experience research method. A/B tests consist of a randomized experiment that usually involves two variants (A and B), although the concept can be also extended to multiple variants of the same variable. It includes application of statistical hypothesis testing or "two-sample hypothesis testing" as used in the field of statistics. A/B testing is employed to compare multiple versions of a single variable, for example by testing a subject's response to variant A against variant B, and to determine which of the variants is more effective. Multivariate testing or multinomial testing is similar to A/B testing but may test more than two versions at the same time or use more controls. Simple A/B tests are not valid for observational, quasi-experimental or other non-experimental situations—commonplace with survey data, offline data, and other, more complex phenomena.
rRNA endonuclease (EC 4.6.1.23, alpha-sarcin) is an enzyme that catalyses the hydrolysis of the phosphodiester linkage between guanosine and adenosine residues at one specific position in the 28S rRNA of rat ribosomes. This ribotoxin also acts on bacterial rRNA. A ribosome-inactivating protein produced by the mold Aspergillus giganteus, alpha-sarcin cleaves the portion of ribosomal RNA that forms the small ribosomal substrate. The high specificity of alpha-sarcin and its efficiency of cleavage are point of study and also account for this protein's very high toxicity level.
Sources: en.wikipedia.org
Subfamily ABCC contains thirteen members and nine of these transporters are referred to as the Multidrug Resistance Proteins (MRPs). The MRP proteins are found throughout nature and they mediate many important functions. They are known to be involved in ion transport, toxin secretion, and signal transduction. Of the nine MRP proteins, four of them, MRP4, 5, 8, 9, (ABCC4, 5, 11, and 12), have a typical ABC structure with four domains, comprising two membrane spanning domains, with each spanning domain followed by a nucleotide binding domain. These are referred to as short MRPs. The remaining 5 MRP's (MRP1, 2, 6, 7) (ABCC1, 2, 3, 6 and 10) are known as long MRPs and feature an additional fifth domain at their N terminus. CFTR, the transporter involved in the disease cystic fibrosis, is also considered part of this subfamily. Cystic fibrosis occurs upon mutation and loss of function of CFTR. The sulfonylurea receptors (SUR), involved in insulin secretion, neuronal function, and muscle function, are also part of this family of proteins. Mutations in SUR proteins are a potential cause of Neonatal diabetes mellitus. SUR is also the binding site for drugs such as sulfonylureas and potassium-channel openers activators such as diazoxide.
Many drugs are metabolised by a set of liver enzymes called CYP450s. The activity of these enzymes would determine the rate of pro-drug activation and the rate of inactivation of active drugs. For example, warfarin, a commonly used anticoagulant drug in atrial fibrillation, is metabolised by an enzyme called CYP2C9. Phenytoin, a CYP2C9 inducer, would increase its activity and the rate of warfarin breakdown, thereby reducing its efficacy. Patients should avoid the co-administration of warfarin and phenytoin. In cases where both drugs must be used together, warfarin dosing may be titrated up to cope with the reduced efficacy. The kidney excretes most drugs through urine. Since urine is weakly alkaline in nature, weakly acid drugs would ionise in urine, making it difficult for them to be reabsorbed. Therefore, in cases of aspirin (weak acid) toxicity, injecting intravenous sodium bicarbonate could increase urine pH, thereby increasing the excretion of aspirin through urine. A similar approach can be used in other weakly acidic drug toxicity.
The post-bioprinting process is necessary to create a stable structure from the biological material. If this process is not well-maintained, the mechanical integrity and function of the 3D printed object is at risk. To maintain the object, both mechanical and chemical stimulations are needed. These stimulations send signals to the cells to control the remodeling and growth of tissues. In addition, in recent development, bioreactor technologies have allowed the rapid maturation of tissues, vascularization of tissues and the ability to survive transplants. Bioreactors work in either providing convective nutrient transport, creating microgravity environments, changing the pressure causing solution to flow through the cells, or adding compression for dynamic or static loading. Each type of bioreactor is ideal for different types of tissue, for example compression bioreactors are ideal for cartilage tissue.
The toxin has two subunits—designated A (mol. wt. 32000 Da) and B (mol. wt. 7700 Da)—and is one of the AB5 toxins. The B subunit is a pentamer that binds to specific glycolipids on the host cell, specifically globotriaosylceramide (Gb3). Following this, the A subunit is internalised and cleaved into two parts. The A1 component then binds to the ribosome, disrupting protein synthesis. Stx-2 has been found to be about 400 times more toxic (as quantified by LD50 in mice) than Stx-1. Gb3 is, for unknown reasons, present in greater amounts in renal epithelial tissues, to which the renal toxicity of Shiga toxin may be attributed. Gb3 is also found in central nervous system neurons and endothelium, which may lead to neurotoxicity. Stx-2 is also known to increase the expression of its receptor GB3 and cause neuronal dysfunctions. 2011 German E. coli outbreak Cholera toxin Enterotoxin Pertussis toxin
Healthcare providers may recommend lifelong heart-healthy lifestyle choices. These choices included a heart-healthy eating plan, physical activity, quitting smoking, improved sleep hygiene, weight loss, blood pressure control, cholesterol control, blood pressure control, and stress management. Some medications may be prescribed to allow the blood vessels to widen and help the heart pump include ACE inhibitors, beta blockers, calcium channel blockers, nitrates, and Ranolazine. Some medications may be prescribed to manage cholesterol include statins, nonstatins, and fribrates. Some medications may be prescribed for other risk factors for heart disease like blood sugar and obesity such as empagliflozin, canagliflozin, metformin, liraglutide, orlistat, and semaglutide. Heart surgery may be needed to treat this condition. Some procedures include percutaneous coronary intervention (PCI), coronary artery bypass grafting (CABG), and transmyocardial laser revascularization (coronary endarterectomy). Preventative procedures like bariatric surgery can help lower coronary heart disease risk.
Sources: en.wikipedia.org
It belongs to the incretin mimetic class and acts as a long-acting glucagon-like peptide-1 receptor agonist. The class includes several peptides with different half-lives and routes of administration.
The side chain enables reversible binding to albumin in the bloodstream, which protects the peptide from rapid renal clearance. This extends the interval between administrations compared with unmodified GLP-1.
No. It shares much of the native sequence but carries substitutions and an added side chain. These changes increase stability against enzymatic breakdown.
It is given either as a once-weekly subcutaneous injection or as an oral tablet taken once daily. The two forms use different absorption strategies, so they are not interchangeable on a milligram-for-milligram basis.